Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Domain d1fm6x_: 1fm6 X: [19317] Other proteins in same PDB: d1fm6a_, d1fm6u_ complexed with 9cr, brl |
PDB Entry: 1fm6 (more details), 2.1 Å
SCOPe Domain Sequences for d1fm6x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fm6x_ a.123.1.1 (X:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi vtehvqllqvikktetdmslhpllqeiykdly
Timeline for d1fm6x_: