Lineage for d1fm6x_ (1fm6 X:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923666Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 923667Species Human (Homo sapiens) [TaxId:9606] [48525] (59 PDB entries)
    Uniprot P37231 232-505
  8. 923709Domain d1fm6x_: 1fm6 X: [19317]
    Other proteins in same PDB: d1fm6a_, d1fm6u_
    complexed with brl, rea

Details for d1fm6x_

PDB Entry: 1fm6 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.
PDB Compounds: (X:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1fm6x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm6x_ a.123.1.1 (X:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d1fm6x_:

Click to download the PDB-style file with coordinates for d1fm6x_.
(The format of our PDB-style files is described here.)

Timeline for d1fm6x_: