Lineage for d1fm6x_ (1fm6 X:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156240Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 156241Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 156242Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (17 proteins)
  6. 156295Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 156296Species Human (Homo sapiens) [TaxId:9606] [48525] (8 PDB entries)
  8. 156303Domain d1fm6x_: 1fm6 X: [19317]
    Other proteins in same PDB: d1fm6a_, d1fm6u_

Details for d1fm6x_

PDB Entry: 1fm6 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.

SCOP Domain Sequences for d1fm6x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm6x_ a.123.1.1 (X:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d1fm6x_:

Click to download the PDB-style file with coordinates for d1fm6x_.
(The format of our PDB-style files is described here.)

Timeline for d1fm6x_: