Lineage for d1fm6d_ (1fm6 D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100952Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 100953Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 100954Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (15 proteins)
  6. 100999Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 101000Species Human (Homo sapiens) [TaxId:9606] [48525] (7 PDB entries)
  8. 101006Domain d1fm6d_: 1fm6 D: [19316]
    Other proteins in same PDB: d1fm6a_, d1fm6u_

Details for d1fm6d_

PDB Entry: 1fm6 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.

SCOP Domain Sequences for d1fm6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm6d_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens)}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d1fm6d_:

Click to download the PDB-style file with coordinates for d1fm6d_.
(The format of our PDB-style files is described here.)

Timeline for d1fm6d_: