Lineage for d1fm9d_ (1fm9 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776796Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 776797Species Human (Homo sapiens) [TaxId:9606] [48525] (46 PDB entries)
    Uniprot P37231 232-505
  8. 776813Domain d1fm9d_: 1fm9 D: [19313]
    Other proteins in same PDB: d1fm9a_
    complexed with 570, rea

Details for d1fm9d_

PDB Entry: 1fm9 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and gi262570 and co-activator peptides.
PDB Compounds: (D:) Peroxisome proliferator activated receptor gamma

SCOP Domain Sequences for d1fm9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm9d_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d1fm9d_:

Click to download the PDB-style file with coordinates for d1fm9d_.
(The format of our PDB-style files is described here.)

Timeline for d1fm9d_: