Lineage for d4j70c_ (4j70 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599563Domain d4j70c_: 4j70 C: [193110]
    Other proteins in same PDB: d4j70a_, d4j70e_, d4j70f_, d4j70i_, d4j70j_, d4j70k_, d4j70l_, d4j70m_, d4j70n_, d4j70o_, d4j70s_, d4j70t_, d4j70w_, d4j70x_, d4j70y_, d4j70z_
    automated match to d1rypd_
    complexed with 1kr

Details for d4j70c_

PDB Entry: 4j70 (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the belactosin derivative 3e
PDB Compounds: (C:) Proteasome component PRE6

SCOPe Domain Sequences for d4j70c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j70c_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d4j70c_:

Click to download the PDB-style file with coordinates for d4j70c_.
(The format of our PDB-style files is described here.)

Timeline for d4j70c_: