Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d4j70b_: 4j70 B: [193109] Other proteins in same PDB: d4j70a_, d4j70e_, d4j70f_, d4j70i_, d4j70j_, d4j70k_, d4j70l_, d4j70m_, d4j70n_, d4j70o_, d4j70s_, d4j70t_, d4j70w_, d4j70x_, d4j70y_, d4j70z_ automated match to d1rypc_ complexed with 1kr |
PDB Entry: 4j70 (more details), 2.8 Å
SCOPe Domain Sequences for d4j70b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j70b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4j70b_: