Lineage for d1eree_ (1ere E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647893Protein Estrogen receptor alpha [48519] (1 species)
  7. 647894Species Human (Homo sapiens) [TaxId:9606] [48520] (22 PDB entries)
  8. 647930Domain d1eree_: 1ere E: [19304]

Details for d1eree_

PDB Entry: 1ere (more details), 3.1 Å

PDB Description: human estrogen receptor ligand-binding domain in complex with 17beta-estradiol
PDB Compounds: (E:) Estrogen receptor

SCOP Domain Sequences for d1eree_:

Sequence, based on SEQRES records: (download)

>d1eree_ a.123.1.1 (E:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahr

Sequence, based on observed residues (ATOM records): (download)

>d1eree_ a.123.1.1 (E:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr

SCOP Domain Coordinates for d1eree_:

Click to download the PDB-style file with coordinates for d1eree_.
(The format of our PDB-style files is described here.)

Timeline for d1eree_: