Lineage for d4bgya_ (4bgy A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117236Protein automated matches [190291] (11 species)
    not a true protein
  7. 1117282Species Influenza virus [TaxId:644788] [193029] (3 PDB entries)
  8. 1117285Domain d4bgya_: 4bgy A: [193038]
    automated match to d2fk0a1
    complexed with epe

Details for d4bgya_

PDB Entry: 4bgy (more details), 2.68 Å

PDB Description: h5 (vn1194) influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgya_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4bgya_:

Click to download the PDB-style file with coordinates for d4bgya_.
(The format of our PDB-style files is described here.)

Timeline for d4bgya_: