Lineage for d4bgzc_ (4bgz C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385857Species Influenza virus [TaxId:375457] [193026] (2 PDB entries)
  8. 2385862Domain d4bgzc_: 4bgz C: [193027]
    Other proteins in same PDB: d4bgzb_, d4bgzd_, d4bgze2, d4bgzf_
    automated match to d2fk0a1
    complexed with nag, po4

Details for d4bgzc_

PDB Entry: 4bgz (more details), 2.68 Å

PDB Description: crystal structure of h5 (tyty) influenza virus haemagglutinin
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4bgzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgzc_ b.19.1.2 (C:) automated matches {Influenza virus [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgihh
pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltig
ecpkyvkssrlvlatglrn

SCOPe Domain Coordinates for d4bgzc_:

Click to download the PDB-style file with coordinates for d4bgzc_.
(The format of our PDB-style files is described here.)

Timeline for d4bgzc_: