SCOPe 2.06: Domain d4j2yb_: 4j2y B:

Lineage for d4j2yb_ (4j2y B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d4j2yb_: 4j2y B: [192982]
   Other proteins in same PDB: d4j2ya_
   automated match to d3mfja_
   complexed with so4

Details for d4j2yb_

PDB Entry: 4j2y, 2 Å

PDB Description: crystal structure of a plant trypsin inhibitor ecti in complex with bovine trypsin.

PDB Compounds: (B:) cationic trypsin

SCOPe Domain Sequences for d4j2yb_:

Sequence; same for both SEQRES and ATOM records:

>d4j2yb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d4j2yb_:

• d4j2yb_ first appeared in SCOPe 2.02
  
• d4j2yb_ appears in SCOPe 2.05
  
• d4j2yb_ appears in SCOPe 2.07
  
• d4j2yb_ appears in the current release, SCOPe 2.08