Lineage for d1a52a_ (1a52 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647893Protein Estrogen receptor alpha [48519] (1 species)
  7. 647894Species Human (Homo sapiens) [TaxId:9606] [48520] (22 PDB entries)
  8. 647919Domain d1a52a_: 1a52 A: [19296]

Details for d1a52a_

PDB Entry: 1a52 (more details), 2.8 Å

PDB Description: estrogen receptor alpha ligand-binding domain complexed to estradiol
PDB Compounds: (A:) Estrogen receptor

SCOP Domain Sequences for d1a52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a52a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml

SCOP Domain Coordinates for d1a52a_:

Click to download the PDB-style file with coordinates for d1a52a_.
(The format of our PDB-style files is described here.)

Timeline for d1a52a_: