SCOPe 2.05: Domain d4eu2e_: 4eu2 E:

Lineage for d4eu2e_ (4eu2 E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4eu2e_: 4eu2 E: [192948]
   Other proteins in same PDB: d4eu21_, d4eu22_, d4eu2a_, d4eu2b_, d4eu2h_, d4eu2k_, d4eu2l_, d4eu2m_, d4eu2n_, d4eu2o_, d4eu2p_, d4eu2q_, d4eu2r_, d4eu2t_, d4eu2u_, d4eu2v_, d4eu2w_, d4eu2x_, d4eu2y_, d4eu2z_
   automated match to d1rype_
   complexed with wpi

Details for d4eu2e_

PDB Entry: 4eu2, 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174

PDB Compounds: (E:) Proteasome component PUP2

SCOPe Domain Sequences for d4eu2e_:

Sequence; same for both SEQRES and ATOM records:

>d4eu2e_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d4eu2e_:

• d4eu2e_ first appeared in SCOPe 2.02
  
• d4eu2e_ appears in SCOPe 2.04
  
• d4eu2e_ appears in SCOPe 2.06
  
• d4eu2e_ appears in the current release, SCOPe 2.08