Lineage for d4eu2e_ (4eu2 E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2549088Domain d4eu2e_: 4eu2 E: [192948]
    Other proteins in same PDB: d4eu21_, d4eu22_, d4eu2a_, d4eu2b_, d4eu2h_, d4eu2k_, d4eu2l_, d4eu2m_, d4eu2n_, d4eu2o_, d4eu2p_, d4eu2q_, d4eu2r_, d4eu2t_, d4eu2u_, d4eu2v_, d4eu2w_, d4eu2x_, d4eu2y_, d4eu2z_
    automated match to d1rype_
    complexed with wpi

Details for d4eu2e_

PDB Entry: 4eu2 (more details), 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174
PDB Compounds: (E:) Proteasome component PUP2

SCOPe Domain Sequences for d4eu2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu2e_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d4eu2e_:

Click to download the PDB-style file with coordinates for d4eu2e_.
(The format of our PDB-style files is described here.)

Timeline for d4eu2e_: