Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein automated matches [190182] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries) |
Domain d4h49c_: 4h49 C: [192934] Other proteins in same PDB: d4h49a2, d4h49b2, d4h49d2 automated match to d1os9a_ complexed with ca, dms, gol, l29, peg, pgo, zn |
PDB Entry: 4h49 (more details), 2.16 Å
SCOPe Domain Sequences for d4h49c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h49c_ d.92.1.11 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglg hssdpkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d4h49c_: