Lineage for d3erda_ (3erd A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217450Protein Estrogen receptor alpha [48519] (1 species)
  7. 217451Species Human (Homo sapiens) [TaxId:9606] [48520] (11 PDB entries)
  8. 217454Domain d3erda_: 3erd A: [19293]

Details for d3erda_

PDB Entry: 3erd (more details), 2.03 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with diethylstilbestrol and a glucocorticoid receptor interacting protein 1 nr box ii peptide

SCOP Domain Sequences for d3erda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erda_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahrlh

SCOP Domain Coordinates for d3erda_:

Click to download the PDB-style file with coordinates for d3erda_.
(The format of our PDB-style files is described here.)

Timeline for d3erda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3erdb_