Lineage for d4il6z_ (4il6 Z:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956946Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. 1956947Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 1956948Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 1956954Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (5 PDB entries)
  8. 1956955Domain d4il6z_: 4il6 Z: [192903]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_
    automated match to d2axtz1
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6z_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d4il6z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d4il6z_:

Click to download the PDB-style file with coordinates for d4il6z_.
(The format of our PDB-style files is described here.)

Timeline for d4il6z_: