Lineage for d4lbd__ (4lbd -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217551Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 217552Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 217561Domain d4lbd__: 4lbd - [19289]
    complexed with 961

Details for d4lbd__

PDB Entry: 4lbd (more details), 2.4 Å

PDB Description: ligand-binding domain of the human retinoic acid receptor gamma bound to the synthetic agonist bms961

SCOP Domain Sequences for d4lbd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbd__ a.123.1.1 (-) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlen

SCOP Domain Coordinates for d4lbd__:

Click to download the PDB-style file with coordinates for d4lbd__.
(The format of our PDB-style files is described here.)

Timeline for d4lbd__: