Lineage for d2lbd__ (2lbd -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins) Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48516] (8 PDB entries) 
Domain d2lbd__: 2lbd - [19287]
Details for d2lbd__
PDB Entry: 2lbd (more details), 2 Å
PDB Description: ligand-binding domain of the human retinoic acid receptor gamma bound to all-trans retinoic acid
SCOP Domain Sequences for d2lbd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lbd__ a.123.1.1 (-) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlenp
SCOP Domain Coordinates for d2lbd__:
Click to download the PDB-style file with coordinates for d2lbd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lbd__:
- d2lbd__ first appeared (with stable ids) in SCOP 1.55
- d2lbd__ appears in SCOP 1.59
- d2lbd__ appears in the current release, SCOPe 2.08, called d2lbda_
View in 3D