SCOPe 2.08: Domain d4elhf1: 4elh F:1-162

Lineage for d4elhf1 (4elh F:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d4elhf1: 4elh F:1-162 [192867]
   Other proteins in same PDB: d4elha2, d4elhb2, d4elhc2, d4elhd2, d4elhe2, d4elhf2, d4elhg2, d4elhh2
   automated match to d3fl8a_
   complexed with 53i, 53j, ca, cl

Details for d4elhf1

PDB Entry: 4elh, 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase

PDB Compounds: (F:) dihydrofolate reductase

SCOPe Domain Sequences for d4elhf1:

Sequence; same for both SEQRES and ATOM records:

>d4elhf1 c.71.1.0 (F:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d4elhf1:

• d4elhf1 first appeared in SCOPe 2.02, called d4elhf_
  
• d4elhf1 appears in SCOPe 2.07