SCOP 1.61: Domain d1exxa_: 1exx A:

Lineage for d1exxa_ (1exx A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (17 proteins)

6. Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48516] (8 PDB entries)

8. Domain d1exxa_: 1exx A: [19286]

Details for d1exxa_

PDB Entry: 1exx, 1.67 Å

PDB Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the inactive s-enantiomer bms270395.

SCOP Domain Sequences for d1exxa_:

Sequence; same for both SEQRES and ATOM records:

>d1exxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

Timeline for d1exxa_:

• d1exxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1exxa_ appears in SCOP 1.59
  
• d1exxa_ appears in SCOP 1.63
  
• d1exxa_ appears in the current release, SCOPe 2.08