Lineage for d4inrr_ (4inr R:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. Species Saccharomyces cerevisiae [TaxId:4932] [192615] (3 PDB entries)
  8. 1224157Domain d4inrr_: 4inr R: [192855]
    Other proteins in same PDB: d4inrk_, d4inry_
    automated match to d1rype_
    complexed with 1g1

Details for d4inrr_

PDB Entry: 4inr (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU102
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d4inrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inrr_ d.153.1.4 (R:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d4inrr_:

Click to download the PDB-style file with coordinates for d4inrr_.
(The format of our PDB-style files is described here.)

Timeline for d4inrr_: