Lineage for d4inrk_ (4inr K:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1437897Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1437913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (45 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1437990Domain d4inrk_: 4inr K: [192852]
    Other proteins in same PDB: d4inra_, d4inrb_, d4inrc_, d4inrd_, d4inrg_, d4inrh_, d4inri_, d4inrj_, d4inrl_, d4inrm_, d4inrn_, d4inro_, d4inrp_, d4inrq_, d4inrr_, d4inru_, d4inrv_, d4inrw_, d4inrx_, d4inrz_
    automated match to d1jd2r_
    complexed with 1g1

Details for d4inrk_

PDB Entry: 4inr (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU102
PDB Compounds: (K:) Proteasome component PRE2

SCOPe Domain Sequences for d4inrk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inrk_ d.153.1.4 (K:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d4inrk_:

Click to download the PDB-style file with coordinates for d4inrk_.
(The format of our PDB-style files is described here.)

Timeline for d4inrk_: