Lineage for d4f7cd_ (4f7c D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1105904Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)
  8. 1105914Domain d4f7cd_: 4f7c D: [192831]
    automated match to d2xfxb_
    complexed with 0sg

Details for d4f7cd_

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: Crystal structure of bovine CD1d with bound C12-di-sulfatide
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d4f7cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7cd_ b.1.1.2 (D:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrd

SCOPe Domain Coordinates for d4f7cd_:

Click to download the PDB-style file with coordinates for d4f7cd_.
(The format of our PDB-style files is described here.)

Timeline for d4f7cd_: