Lineage for d1fcza_ (1fcz A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217551Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 217552Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 217554Domain d1fcza_: 1fcz A: [19283]
    complexed with 156, lmu

Details for d1fcza_

PDB Entry: 1fcz (more details), 1.38 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the panagonist retinoid bms181156

SCOP Domain Sequences for d1fcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcza_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOP Domain Coordinates for d1fcza_:

Click to download the PDB-style file with coordinates for d1fcza_.
(The format of our PDB-style files is described here.)

Timeline for d1fcza_: