Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (7 PDB entries) |
Domain d3r8bh_: 3r8b H: [192780] Other proteins in same PDB: d3r8ba1, d3r8ba2, d3r8bc1, d3r8bc2, d3r8be1, d3r8be2, d3r8bg1, d3r8bg2, d3r8bi1, d3r8bi2, d3r8bk1, d3r8bk2, d3r8bm1, d3r8bm2, d3r8bo1, d3r8bo2 automated match to d2apfa_ complexed with cl, so4, zn |
PDB Entry: 3r8b (more details), 2.95 Å
SCOPe Domain Sequences for d3r8bh_:
Sequence, based on SEQRES records: (download)
>d3r8bh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs
>d3r8bh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvlygs
Timeline for d3r8bh_: