Lineage for d1fm6u_ (1fm6 U:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776945Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 776946Species Human (Homo sapiens) [TaxId:9606] [48511] (18 PDB entries)
    Uniprot P19793 227-458
  8. 776966Domain d1fm6u_: 1fm6 U: [19278]
    Other proteins in same PDB: d1fm6d_, d1fm6x_
    complexed with brl, rea

Details for d1fm6u_

PDB Entry: 1fm6 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.
PDB Compounds: (U:) Retinoic acid receptor RXR-alpha

SCOP Domain Sequences for d1fm6u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm6u_ a.123.1.1 (U:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1fm6u_:

Click to download the PDB-style file with coordinates for d1fm6u_.
(The format of our PDB-style files is described here.)

Timeline for d1fm6u_: