Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (15 species) not a true protein |
Species Mus musculus [TaxId:10090] [192765] (2 PDB entries) |
Domain d3owec_: 3owe C: [192766] automated match to d2apba_ mutant |
PDB Entry: 3owe (more details), 2.6 Å
SCOPe Domain Sequences for d3owec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3owec_ b.1.1.1 (C:) automated matches {Mus musculus [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d3owec_: