Lineage for d2x36e_ (2x36 E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194661Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1194662Protein automated matches [190826] (3 species)
    not a true protein
  7. 1194663Species Homo sapiens [TaxId:9606] [192754] (1 PDB entry)
  8. 1194667Domain d2x36e_: 2x36 E: [192759]
    automated match to d1xhkb_

Details for d2x36e_

PDB Entry: 2x36 (more details), 2 Å

PDB Description: structure of the proteolytic domain of the human mitochondrial lon protease
PDB Compounds: (E:) lon protease homolog, mitochondrial

SCOPe Domain Sequences for d2x36e_:

Sequence, based on SEQRES records: (download)

>d2x36e_ d.14.1.0 (E:) automated matches {Homo sapiens [TaxId: 9606]}
dvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkesaria
ytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnl
amtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfve
hyreifdiafp

Sequence, based on observed residues (ATOM records): (download)

>d2x36e_ d.14.1.0 (E:) automated matches {Homo sapiens [TaxId: 9606]}
dvtppgvvmglawtamggstlfvetslrrdgslevtgqlgevmkesariaytfaraflmq
hapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltg
kilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiaf
p

SCOPe Domain Coordinates for d2x36e_:

Click to download the PDB-style file with coordinates for d2x36e_.
(The format of our PDB-style files is described here.)

Timeline for d2x36e_: