Class b: All beta proteins [48724] (177 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
Species Human (Homo sapiens) [TaxId:9606] [101614] (5 PDB entries) |
Domain d2wnua_: 2wnu A: [192751] Other proteins in same PDB: d2wnub_, d2wnuc_, d2wnue_, d2wnuf_ automated match to d1pk6a_ complexed with nag |
PDB Entry: 2wnu (more details), 2.3 Å
SCOPe Domain Sequences for d2wnua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnua_ b.22.1.1 (A:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]} qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse adsvfsgflifps
Timeline for d2wnua_: