Lineage for d1fs2b1 (1fs2 B:80-146)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362084Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 362085Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 362086Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 362091Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 362092Species Human (Homo sapiens) [TaxId:9606] [81376] (5 PDB entries)
  8. 362095Domain d1fs2b1: 1fs2 B:80-146 [19272]
    Other proteins in same PDB: d1fs2a1, d1fs2a2, d1fs2b2, d1fs2c1, d1fs2c2, d1fs2d2

Details for d1fs2b1

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2b1 a.157.1.1 (B:80-146) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf
nikndft

SCOP Domain Coordinates for d1fs2b1:

Click to download the PDB-style file with coordinates for d1fs2b1.
(The format of our PDB-style files is described here.)

Timeline for d1fs2b1: