Lineage for d1fs2b1 (1fs2 B:80-146)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156209Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
  4. 156210Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family) (S)
  5. 156211Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
  6. 156212Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
  7. 156213Species Human (Homo sapiens) [TaxId:9606] [48506] (4 PDB entries)
  8. 156235Domain d1fs2b1: 1fs2 B:80-146 [19272]
    Other proteins in same PDB: d1fs2a2, d1fs2b2, d1fs2c2, d1fs2d2

Details for d1fs2b1

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2b1 a.122.1.1 (B:80-146) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
krtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktf
nikndft

SCOP Domain Coordinates for d1fs2b1:

Click to download the PDB-style file with coordinates for d1fs2b1.
(The format of our PDB-style files is described here.)

Timeline for d1fs2b1: