Lineage for d1fs2c1 (1fs2 C:105-145)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50815Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
  4. 50816Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family) (S)
  5. 50817Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
  6. 50818Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
  7. 50819Species Human (Homo sapiens) [TaxId:9606] [48506] (3 PDB entries)
  8. 50842Domain d1fs2c1: 1fs2 C:105-145 [19271]
    Other proteins in same PDB: d1fs2a2, d1fs2b2, d1fs2c2, d1fs2d2

Details for d1fs2c1

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2c1 a.122.1.1 (C:105-145) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
pgvswdslpdelllgifsclclpellkvsgvckrwyrlasd

SCOP Domain Coordinates for d1fs2c1:

Click to download the PDB-style file with coordinates for d1fs2c1.
(The format of our PDB-style files is described here.)

Timeline for d1fs2c1:

50842
d1fs2c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fs2c2