Lineage for d1fs2c1 (1fs2 C:105-145)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735529Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 2735530Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 2735531Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 2735546Protein Skp2 [81379] (1 species)
  7. 2735547Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)
  8. 2735561Domain d1fs2c1: 1fs2 C:105-145 [19271]
    Other proteins in same PDB: d1fs2a2, d1fs2b1, d1fs2b2, d1fs2c2, d1fs2d1, d1fs2d2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1fs2c1

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (C:) skp2

SCOPe Domain Sequences for d1fs2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2c1 a.158.1.1 (C:105-145) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
pgvswdslpdelllgifsclclpellkvsgvckrwyrlasd

SCOPe Domain Coordinates for d1fs2c1:

Click to download the PDB-style file with coordinates for d1fs2c1.
(The format of our PDB-style files is described here.)

Timeline for d1fs2c1:

2735561
d1fs2c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fs2c2