Lineage for d2quyc_ (2quy C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230577Species Bacillus sphaericus [TaxId:1421] [192699] (1 PDB entry)
  8. 2230580Domain d2quyc_: 2quy C: [192703]
    Other proteins in same PDB: d2quyd_
    automated match to d2oqca_
    complexed with cl; mutant

Details for d2quyc_

PDB Entry: 2quy (more details), 1.7 Å

PDB Description: truncated mutant asn175ala of penicillin v acylase from bacillus sphaericus
PDB Compounds: (C:) penicillin acylase

SCOPe Domain Sequences for d2quyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quyc_ d.153.1.0 (C:) automated matches {Bacillus sphaericus [TaxId: 1421]}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtaspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnq

SCOPe Domain Coordinates for d2quyc_:

Click to download the PDB-style file with coordinates for d2quyc_.
(The format of our PDB-style files is described here.)

Timeline for d2quyc_: