| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
| Family a.158.1.1: F-box domain [81381] (4 proteins) |
| Protein Skp2 [81379] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
| Domain d1fs2a1: 1fs2 A:105-145 [19270] Other proteins in same PDB: d1fs2a2, d1fs2b1, d1fs2b2, d1fs2c2, d1fs2d1, d1fs2d2 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOPe Domain Sequences for d1fs2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2a1 a.158.1.1 (A:105-145) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
pgvswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fs2a1: