Lineage for d2eioa_ (2eio A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168122Protein Thioredoxin [52835] (14 species)
  7. 1168138Species Escherichia coli [TaxId:562] [52836] (45 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 1168202Domain d2eioa_: 2eio A: [192695]
    automated match to d2trxa_

Details for d2eioa_

PDB Entry: 2eio (more details), 2.6 Å

PDB Description: Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d2eioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eioa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldanla

SCOPe Domain Coordinates for d2eioa_:

Click to download the PDB-style file with coordinates for d2eioa_.
(The format of our PDB-style files is described here.)

Timeline for d2eioa_: