Lineage for d4k0oa_ (4k0o A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1772083Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 1772098Protein automated matches [190525] (1 species)
    not a true protein
  7. 1772099Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)
  8. 1772101Domain d4k0oa_: 4k0o A: [192681]
    automated match to d3ffoa_
    complexed with ni, so4

Details for d4k0oa_

PDB Entry: 4k0o (more details), 2.15 Å

PDB Description: f17b-g lectin domain with bound glcnac(beta1-3)gal
PDB Compounds: (A:) F17b-G fimbrial adhesin

SCOPe Domain Sequences for d4k0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k0oa_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

SCOPe Domain Coordinates for d4k0oa_:

Click to download the PDB-style file with coordinates for d4k0oa_.
(The format of our PDB-style files is described here.)

Timeline for d4k0oa_: