Lineage for d4i7zb_ (4i7z B:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239405Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1239406Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1239407Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1239447Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 1239450Species Mastigocladus laminosus [TaxId:83541] [103496] (6 PDB entries)
  8. 1239451Domain d4i7zb_: 4i7z B: [192679]
    Other proteins in same PDB: d4i7za_, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_
    automated match to d2e74b1
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zb_

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4i7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7zb_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam
vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq
npfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d4i7zb_:

Click to download the PDB-style file with coordinates for d4i7zb_.
(The format of our PDB-style files is described here.)

Timeline for d4i7zb_: