Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein automated matches [190340] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189355] (16 PDB entries) |
Domain d4aa1a_: 4aa1 A: [192658] automated match to d2x97a_ complexed with nag, zn |
PDB Entry: 4aa1 (more details), 1.99 Å
SCOPe Domain Sequences for d4aa1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aa1a_ d.92.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} alvkeeiqakeylenlnkelakrtnveteaawaygsnitdenekkkneisaelakfmkev asdttkfqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdyk dstkcdlaldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnn ftsgaeawldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipm hllgnmwaqqwseiadivspfpekplvdvsaemekqgytplkmfqmgddfftsmnltklp qdfwdksiiekptdgrdlvchasawdfyltddvrikqctrvtqdqlftvhhelghiqyfl qyqhqpfvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltal dkivflpfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapaky hisadveylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaaagaafhnml smgaskpwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwttsnkcvs
Timeline for d4aa1a_: