Lineage for d4fane_ (4fan E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034455Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 3034477Domain d4fane_: 4fan E: [192650]
    Other proteins in same PDB: d4fanc2
    automated match to d2bbkl_
    complexed with act, ca, edo, hec, mes, na, pge

Details for d4fane_

PDB Entry: 4fan (more details), 2.08 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 40 Days
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fane_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fane_ g.21.1.1 (E:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4fane_:

Click to download the PDB-style file with coordinates for d4fane_.
(The format of our PDB-style files is described here.)

Timeline for d4fane_: