SCOPe 2.08: Domain d4ja1b_: 4ja1 B:

Lineage for d4ja1b_ (4ja1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d4ja1b_: 4ja1 B: [192647]
   automated match to d1hy7b_
   complexed with ca, cl, ngh, pt, zn

Details for d4ja1b_

PDB Entry: 4ja1, 1.96 Å

PDB Description: Structure of MMP3 complexed with a platinum-based inhibitor

PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d4ja1b_:

Sequence; same for both SEQRES and ATOM records:

>d4ja1b_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfav
rehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighslg
lfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d4ja1b_:

• d4ja1b_ first appeared in SCOPe 2.02
  
• d4ja1b_ appears in SCOPe 2.07