SCOPe 2.05: Domain d4alra_: 4alr A:

Lineage for d4alra_ (4alr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries)

8. Domain d4alra_: 4alr A: [192640]
   automated match to d4a02a_
   complexed with cu, peg

Details for d4alra_

PDB Entry: 4alr, 1.49 Å

PDB Description: x-ray photoreduction of polysaccharide monooxygenase cbm33

PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d4alra_:

Sequence; same for both SEQRES and ATOM records:

>d4alra_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq

Timeline for d4alra_:

• d4alra_ first appeared in SCOPe 2.02
  
• d4alra_ appears in SCOPe 2.04
  
• d4alra_ appears in SCOPe 2.06
  
• d4alra_ appears in the current release, SCOPe 2.08