Class a: All alpha proteins [46456] (258 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries) |
Domain d1fqvf1: 1fqv F:85-160 [19264] Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd2, d1fqve1, d1fqve2, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOP Domain Sequences for d1fqvf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvf1 a.157.1.1 (F:85-160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrkenqwc
Timeline for d1fqvf1:
View in 3D Domains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |