SCOPe 2.08: Domain d4gr0a1: 4gr0 A:106-263

Lineage for d4gr0a1 (4gr0 A:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d4gr0a1: 4gr0 A:106-263 [192621]
   Other proteins in same PDB: d4gr0a2
   automated match to d1os9a_
   complexed with ca, r4b, zn

Details for d4gr0a1

PDB Entry: 4gr0, 1.5 Å

PDB Description: Crystal structure of the catalytic domain of Human MMP12 in complex with selective phosphinic inhibitor RXP470B

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4gr0a1:

Sequence; same for both SEQRES and ATOM records:

>d4gr0a1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d4gr0a1:

• d4gr0a1 first appeared in SCOPe 2.02, called d4gr0a_
  
• d4gr0a1 appears in SCOPe 2.07