Class a: All alpha proteins [46456] (171 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (2 proteins) |
Protein Skp2 [81379] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries) |
Domain d1fqvo1: 1fqv O:107-145 [19261] Other proteins in same PDB: d1fqva2, d1fqvb1, d1fqvb2, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo2, d1fqvp1, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOP Domain Sequences for d1fqvo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvo1 a.158.1.1 (O:107-145) Skp2 {Human (Homo sapiens)} vswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fqvo1:
View in 3D Domains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvp1, d1fqvp2 |