SCOPe 2.08: Domain d3uvcb1: 3uvc B:106-263

Lineage for d3uvcb1 (3uvc B:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d3uvcb1: 3uvc B:106-263 [192589]
   Other proteins in same PDB: d3uvcb2
   automated match to d2wo9c_
   complexed with 0d2, ca, cl, edo, imd, zn

Details for d3uvcb1

PDB Entry: 3uvc, 1.3 Å

PDB Description: MMP12 in a complex with the dimeric adduct: 5-(5-phenylhydantoin)-5-phenylhydantoin

PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d3uvcb1:

Sequence; same for both SEQRES and ATOM records:

>d3uvcb1 d.92.1.11 (B:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d3uvcb1:

• d3uvcb1 first appeared in SCOPe 2.02, called d3uvcb_
  
• d3uvcb1 appears in SCOPe 2.07