SCOP 1.59: Domain d1fqvi1: 1fqv I:107-145

Lineage for d1fqvi1 (1fqv I:107-145)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)

4. Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family)

5. Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)

6. Protein Skp1-Skp2 dimerisation domains [48505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48506] (3 PDB entries)

8. Domain d1fqvi1: 1fqv I:107-145 [19258]
   Other proteins in same PDB: d1fqva2, d1fqvb2, d1fqvc2, d1fqvd2, d1fqve2, d1fqvf2, d1fqvg2, d1fqvh2, d1fqvi2, d1fqvj2, d1fqvk2, d1fqvl2, d1fqvm2, d1fqvn2, d1fqvo2, d1fqvp2

Details for d1fqvi1

PDB Entry: 1fqv, 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fqvi1:

Sequence; same for both SEQRES and ATOM records:

>d1fqvi1 a.122.1.1 (I:107-145) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd

Timeline for d1fqvi1:

• d1fqvi1 first appeared (with stable ids) in SCOP 1.55
  
• d1fqvi1 appears in SCOP 1.57
  
• d1fqvi1 appears in SCOP 1.61
  
• d1fqvi1 appears in the current release, SCOPe 2.08