Class a: All alpha proteins [46456] (284 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein Skp2 [81379] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
Domain d1fqvg1: 1fqv G:107-145 [19257] Other proteins in same PDB: d1fqva2, d1fqvb1, d1fqvb2, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo2, d1fqvp1, d1fqvp2 |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqvg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvg1 a.158.1.1 (G:107-145) Skp2 {Human (Homo sapiens) [TaxId: 9606]} vswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fqvg1:
View in 3D Domains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |