Lineage for d1fqve1 (1fqv E:107-145)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362107Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 362108Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 362109Family a.158.1.1: F-box domain [81381] (3 proteins)
  6. 362117Protein Skp2 [81379] (1 species)
  7. 362118Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries)
  8. 362125Domain d1fqve1: 1fqv E:107-145 [19256]
    Other proteins in same PDB: d1fqva2, d1fqvb1, d1fqvb2, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo2, d1fqvp1, d1fqvp2

Details for d1fqve1

PDB Entry: 1fqv (more details), 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fqve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqve1 a.158.1.1 (E:107-145) Skp2 {Human (Homo sapiens)}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd

SCOP Domain Coordinates for d1fqve1:

Click to download the PDB-style file with coordinates for d1fqve1.
(The format of our PDB-style files is described here.)

Timeline for d1fqve1: